PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.041880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 321aa    MW: 35409.9 Da    PI: 6.8363
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.041880.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.4e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l  +++q+G+++W++I++  g+ R++k+c++rw +yl
   Cucsa.041880.1 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding42.91.1e-1368110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++  E++ +v+++   G++ W++Ia+ ++ gRt++++k++w++
   Cucsa.041880.1  68 GQFSDIEEQTIVKLHSVVGNR-WSLIAAQLP-GRTDNDVKNHWNT 110
                      678888***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.82965IPR017930Myb domain
SuperFamilySSF466896.97E-2911108IPR009057Homeodomain-like
SMARTSM007176.0E-141363IPR001005SANT/Myb domain
PfamPF002493.1E-171461IPR001005SANT/Myb domain
CDDcd001671.76E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2365116IPR009057Homeodomain-like
SMARTSM007177.3E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.51566116IPR017930Myb domain
PfamPF002495.8E-1268110IPR001005SANT/Myb domain
CDDcd001671.23E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SDIEEQTIVK LHSVVGNRWS LIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEIATTL APPQVAHLAE AALGCFKDEM LHLLTKKRVD FQLQQANIPP  180
GTSTGTYIHG KENERDGTVE NIKLGLSRAI QQPDLIPPYK PWSSADAAGT SNCFPQSTSG  240
FQYAPLTFGS EGDGSSWSQS ICTGSTCTAG EQQGQLHEIL EENEEGLSEG GKEIRNGTSI  300
FSSDSVLWDL PCDDLMNPIV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818600.0LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148287.10.0PREDICTED: myb-related protein 308 isoform X1
SwissprotQ7XQN11e-121MYB80_ORYSJ; Transcription factor MYB80
TrEMBLM5WEW70.0M5WEW7_PRUPE; Uncharacterized protein
STRINGVIT_19s0015g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108783039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-119myb domain protein 103